PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 375aa    MW: 41850.5 Da    PI: 6.3724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015608genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++++  +G g+W+++++  g  R++k+c++rw +yl
      Lus10015608 14 RGLWSPEEDEKLINYISTYGHGCWSSVPKLAGIQRCGKSCRLRWINYL 61
                     788*****************************66************97 PP

2Myb_DNA-binding49.87.6e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l++++++ lG++ W+ Ia++++ gRt++++k++w+
      Lus10015608  67 RGSFSPQEAALIIELHTILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.309961IPR017930Myb domain
SuperFamilySSF466892.85E-2911108IPR009057Homeodomain-like
SMARTSM007177.9E-141363IPR001005SANT/Myb domain
PfamPF002494.8E-161461IPR001005SANT/Myb domain
CDDcd001678.62E-121761No hitNo description
PROSITE profilePS5129424.9362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2565117IPR009057Homeodomain-like
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002498.2E-1467110IPR001005SANT/Myb domain
CDDcd001676.63E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIS TYGHGCWSSV PKLAGIQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHTILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLISHH  120
LHHQFHHGVM INVPPSGPSG FDPNSSSSAS SSLLSGGGEE AFFSANHHHM LVSPSPSNNN  180
IINDVSSSSV LQSYGNITIS DHHHFNLFDQ QYFPNPFLIN SSSSSSSPSS LLNIINDPIW  240
PPPPSFPFLP QQHYDHQHLL MMNNIDQDQH HDQILITNVN NDDDGTKQDD HDHQISIPYD  300
NDDDDLLMMP SSPKLSDQAP PKQEDQDHPL SMTSPPPPMA ASSSQIDDHQ YMEAMFISSL  360
PSPSPAFLGW NMTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8861821e-61HQ886182.1 Linum usitatissimum clone Contig2131 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024519.12e-88MYB7
TrEMBLA0A061GC442e-88A0A061GC44_THECC; MYB7
STRINGPOPTR_0001s20370.19e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.24e-75myb domain protein 26